Lineage for d6sxta1 (6sxt A:19-337)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390181Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
    automatically mapped to Pfam PF09206
  6. 2390186Protein automated matches [254503] (2 species)
    not a true protein
  7. 2390187Species Aspergillus kawachii [TaxId:1033177] [381509] (2 PDB entries)
  8. 2390188Domain d6sxta1: 6sxt A:19-337 [381510]
    Other proteins in same PDB: d6sxta2, d6sxta3
    automated match to d1wd3a1
    complexed with act, ala, edo, lxe, nag, peg, pge, so4

Details for d6sxta1

PDB Entry: 6sxt (more details), 1.47 Å

PDB Description: gh54 a-l-arabinofuranosidase soaked with aziridine inhibitor
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d6sxta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxta1 b.29.1.21 (A:19-337) automated matches {Aspergillus kawachii [TaxId: 1033177]}
gpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaqd
tfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkaygv
fmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmeai
ylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwair
ganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgypsd
dtensvqenivaakyvvgs

SCOPe Domain Coordinates for d6sxta1:

Click to download the PDB-style file with coordinates for d6sxta1.
(The format of our PDB-style files is described here.)

Timeline for d6sxta1: