SCOPe 2.08: Domain d3fruc2: 3fru C:1-178

Lineage for d3fruc2 (3fru C:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (2 species)
   class I MHC-related

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)

8. Domain d3fruc2: 3fru C:1-178 [38151]
   Other proteins in same PDB: d3frua1, d3frub_, d3fruc1, d3frud_, d3frue1, d3fruf_
   complexed with bme, nag, so4

Details for d3fruc2

PDB Entry: 3fru, 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

PDB Compounds: (C:) neonatal fc receptor

SCOPe Domain Sequences for d3fruc2:

Sequence; same for both SEQRES and ATOM records:

>d3fruc2 d.19.1.1 (C:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

Timeline for d3fruc2:

• d3fruc2 first appeared (with stable ids) in SCOP 1.55
  
• d3fruc2 appears in SCOPe 2.07