Lineage for d6qn2b_ (6qn2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2422210Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2422211Protein automated matches [191011] (16 species)
    not a true protein
  7. 2422292Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)
  8. 2422352Domain d6qn2b_: 6qn2 B: [381496]
    automated match to d1hcba_
    complexed with j92, zn

Details for d6qn2b_

PDB Entry: 6qn2 (more details), 1.95 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with benzenesulfonamide
PDB Compounds: (B:) Carbonic anhydrase 9

SCOPe Domain Sequences for d6qn2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qn2b_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfp

SCOPe Domain Coordinates for d6qn2b_:

Click to download the PDB-style file with coordinates for d6qn2b_.
(The format of our PDB-style files is described here.)

Timeline for d6qn2b_: