SCOPe 2.07: Domain d6qona1: 6qon A:1-227

Lineage for d6qona1 (6qon A:1-227)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (22 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:36809] [374339] (56 PDB entries)

8. Domain d6qona1: 6qon A:1-227 [381432]
   Other proteins in same PDB: d6qona2, d6qonb2
   automated match to d1oy5a_
   protein/RNA complex; complexed with j9w, so4

Details for d6qona1

PDB Entry: 6qon, 1.81 Å

PDB Description: crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with fragment 17 (2h-1,3- benzoxazine-2,4(3h)-dione)

PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d6qona1:

Sequence, based on SEQRES records:

>d6qona1 c.116.1.0 (A:1-227) automated matches {Mycobacterium abscessus [TaxId: 36809]}
mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv
mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad
daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaqedshsegmaslle
gpsytrppswrgmdvppvllsgdhakiaawraeqsrqrtierrpdll

Sequence, based on observed residues (ATOM records):

>d6qona1 c.116.1.0 (A:1-227) automated matches {Mycobacterium abscessus [TaxId: 36809]}
mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv
mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad
daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnasllegpsytrppswrgm
dvppvllsgdhakiaawraeqsrqrtierrpdll

Timeline for d6qona1:

• d6qona1 is new in SCOPe 2.07-stable
  
• d6qona1 appears in the current release, SCOPe 2.08