Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries) |
Domain d6qn5a_: 6qn5 A: [381379] automated match to d1hcba_ complexed with j8n, zn |
PDB Entry: 6qn5 (more details), 1.96 Å
SCOPe Domain Sequences for d6qn5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qn5a_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp lngrvieasfp
Timeline for d6qn5a_: