Lineage for d6p7ca3 (6p7c A:216-457)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519171Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2519172Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2519173Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2519384Protein automated matches [190790] (4 species)
    not a true protein
  7. 2519389Species Salmonella typhimurium [TaxId:90371] [381349] (9 PDB entries)
  8. 2519404Domain d6p7ca3: 6p7c A:216-457 [381367]
    Other proteins in same PDB: d6p7ca1, d6p7ca2, d6p7cb1, d6p7cb2
    automated match to d1pjqa2
    complexed with cl, sah

Details for d6p7ca3

PDB Entry: 6p7c (more details), 2.76 Å

PDB Description: d104a/s128a s. typhimurium siroheme synthase
PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d6p7ca3:

Sequence, based on SEQRES records: (download)

>d6p7ca3 c.90.1.1 (A:216-457) automated matches {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d6p7ca3 c.90.1.1 (A:216-457) automated matches {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkvpqee
inqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsaysg
iplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekliafgmqa
dmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOPe Domain Coordinates for d6p7ca3:

Click to download the PDB-style file with coordinates for d6p7ca3.
(The format of our PDB-style files is described here.)

Timeline for d6p7ca3: