SCOPe 2.07: Domain d6pr0a1: 6pr0 A:1-113

Lineage for d6pr0a1 (6pr0 A:1-113)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [381343] (9 PDB entries)

8. Domain d6pr0a1: 6pr0 A:1-113 [381352]
   Other proteins in same PDB: d6pr0a2, d6pr0a3, d6pr0b2, d6pr0b3
   automated match to d1pjqa1
   complexed with sah

Details for d6pr0a1

PDB Entry: 6pr0, 1.9 Å

PDB Description: p133h-s128a s. typhimurium siroheme synthase

PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d6pr0a1:

Sequence; same for both SEQRES and ATOM records:

>d6pr0a1 c.2.1.0 (A:1-113) automated matches {Salmonella typhimurium [TaxId: 90371]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

Timeline for d6pr0a1:

• d6pr0a1 is new in SCOPe 2.07-stable
  
• d6pr0a1 appears in the current release, SCOPe 2.08