Lineage for d6vsax_ (6vsa X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556750Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins)
    Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. 2556758Protein YwfI homologue [110966] (3 species)
  7. 2556765Species Geobacillus sp. [TaxId:550542] [381220] (2 PDB entries)
  8. 2556768Domain d6vsax_: 6vsa X: [381261]
    automated match to d1t0tv_

Details for d6vsax_

PDB Entry: 6vsa (more details), 2.32 Å

PDB Description: single particle reconstruction of hemq from geobacillus based on data acquired in the presence of substantial aberrations
PDB Compounds: (X:) HemQ

SCOPe Domain Sequences for d6vsax_:

Sequence, based on SEQRES records: (download)

>d6vsax_ d.58.4.10 (X:) YwfI homologue {Geobacillus sp. [TaxId: 550542]}
aaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavyti
vgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedpyq
ipevrrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvt
qiitgsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvs
sffhv

Sequence, based on observed residues (ATOM records): (download)

>d6vsax_ d.58.4.10 (X:) YwfI homologue {Geobacillus sp. [TaxId: 550542]}
aaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavyti
vgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelpyqipevrrrlyp
ilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqiitgsvgld
dfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvssffhv

SCOPe Domain Coordinates for d6vsax_:

Click to download the PDB-style file with coordinates for d6vsax_.
(The format of our PDB-style files is described here.)

Timeline for d6vsax_: