Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [381227] (1 PDB entry) |
Domain d6vfnf_: 6vfn F: [381241] automated match to d5cnpc_ complexed with spm |
PDB Entry: 6vfn (more details), 2.5 Å
SCOPe Domain Sequences for d6vfnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vfnf_ d.108.1.0 (F:) automated matches {Bacillus thuringiensis [TaxId: 1428]} elklrpleredlkfvhelnnnahimsywfeepyeafvelqdlydkhihdqserrfivekd nemvglvelveidyihrrtefqiiidpnyqgygyavdatrlamdyafsvlnmhkiylvvd kenekavhvykkvgfmvegelideffvdgnyhnairmcmfqkqyfen
Timeline for d6vfnf_: