Lineage for d6u9aa_ (6u9a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2580057Protein automated matches [190229] (13 species)
    not a true protein
  7. 2580090Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)
  8. 2580183Domain d6u9aa_: 6u9a A: [381195]
    automated match to d2xjxa_
    complexed with q2a

Details for d6u9aa_

PDB Entry: 6u9a (more details), 1.65 Å

PDB Description: hsp90a ntd k58r bound reversibly to sulfonyl fluoride 5
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d6u9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u9aa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldriryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d6u9aa_:

Click to download the PDB-style file with coordinates for d6u9aa_.
(The format of our PDB-style files is described here.)

Timeline for d6u9aa_: