Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins) |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries) |
Domain d6v7lb2: 6v7l B:246-424 [381192] automated match to d2cava2 complexed with bez |
PDB Entry: 6v7l (more details), 2.8 Å
SCOPe Domain Sequences for d6v7lb2:
Sequence, based on SEQRES records: (download)
>d6v7lb2 b.82.1.2 (B:246-424) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi lvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaasdlnmv gigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqpr
>d6v7lb2 b.82.1.2 (B:246-424) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi lvanegraevelvglmqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenne rnflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqpr
Timeline for d6v7lb2:
View in 3D Domains from other chains: (mouse over for more information) d6v7la1, d6v7la2, d6v7lc1, d6v7lc2 |