Lineage for d6v7lb2 (6v7l B:246-424)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2423995Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 2424019Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2424029Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries)
  8. 2424065Domain d6v7lb2: 6v7l B:246-424 [381192]
    automated match to d2cava2
    complexed with bez

Details for d6v7lb2

PDB Entry: 6v7l (more details), 2.8 Å

PDB Description: the structure of the p212121 crystal form of canavalin at 173 k
PDB Compounds: (B:) canavalin

SCOPe Domain Sequences for d6v7lb2:

Sequence, based on SEQRES records: (download)

>d6v7lb2 b.82.1.2 (B:246-424) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaasdlnmv
gigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqpr

Sequence, based on observed residues (ATOM records): (download)

>d6v7lb2 b.82.1.2 (B:246-424) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvglmqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenne
rnflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqpr

SCOPe Domain Coordinates for d6v7lb2:

Click to download the PDB-style file with coordinates for d6v7lb2.
(The format of our PDB-style files is described here.)

Timeline for d6v7lb2: