Lineage for d6r42a2 (6r42 A:222-563)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620586Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196777] (34 PDB entries)
  8. 2620603Domain d6r42a2: 6r42 A:222-563 [381164]
    Other proteins in same PDB: d6r42a1, d6r42a3
    automated match to d4kqra2
    complexed with jpp; mutant

Details for d6r42a2

PDB Entry: 6r42 (more details), 1.72 Å

PDB Description: structure of r504c mutant of pseudomonas aeruginosa penicillin-binding protein 3 (pbp3) in complex with piperacillin
PDB Compounds: (A:) Peptidoglycan D,D-transpeptidase FtsI

SCOPe Domain Sequences for d6r42a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r42a2 e.3.1.0 (A:222-563) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam
rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld
ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae
tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml
qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenaycslfagfapatdpriamv
vvidepskagyfgglvsapvfskvmagalrlmnvppdnlpta

SCOPe Domain Coordinates for d6r42a2:

Click to download the PDB-style file with coordinates for d6r42a2.
(The format of our PDB-style files is described here.)

Timeline for d6r42a2: