Lineage for d6si9a1 (6si9 A:12-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472341Species Staphylococcus aureus [TaxId:1280] [378968] (7 PDB entries)
  8. 2472347Domain d6si9a1: 6si9 A:12-208 [381117]
    Other proteins in same PDB: d6si9a2, d6si9a3
    automated match to d4m8ia1
    complexed with ca, edo, gdp

Details for d6si9a1

PDB Entry: 6si9 (more details), 1.9 Å

PDB Description: ftsz-refold
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d6si9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6si9a1 c.32.1.1 (A:12-208) automated matches {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d6si9a1:

Click to download the PDB-style file with coordinates for d6si9a1.
(The format of our PDB-style files is described here.)

Timeline for d6si9a1: