Lineage for d6rvmc1 (6rvm C:12-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472341Species Staphylococcus aureus [TaxId:1280] [378968] (7 PDB entries)
  8. 2472350Domain d6rvmc1: 6rvm C:12-208 [381102]
    Other proteins in same PDB: d6rvma2, d6rvmb2, d6rvmc2, d6rvmc3, d6rvmd2, d6rvmd3
    automated match to d4m8ia1
    complexed with cl, gol, mg, so4

Details for d6rvmc1

PDB Entry: 6rvm (more details), 2.16 Å

PDB Description: cell division protein ftsz from staphylococcus aureus, apo form
PDB Compounds: (C:) cell division protein ftsz

SCOPe Domain Sequences for d6rvmc1:

Sequence, based on SEQRES records: (download)

>d6rvmc1 c.32.1.1 (C:12-208) automated matches {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

Sequence, based on observed residues (ATOM records): (download)

>d6rvmc1 c.32.1.1 (C:12-208) automated matches {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgnvefiaintdgqalnlskaeskiqigekltrglgaga
npeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvt
rpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqg
vqgisdliavsgevn

SCOPe Domain Coordinates for d6rvmc1:

Click to download the PDB-style file with coordinates for d6rvmc1.
(The format of our PDB-style files is described here.)

Timeline for d6rvmc1: