SCOPe 2.07: Domain d6puke1: 6puk E:2-116

Lineage for d6puke1 (6puk E:2-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6puke1: 6puk E:2-116 [380839]
   Other proteins in same PDB: d6puka1, d6puka3, d6pukb2, d6pukc1, d6pukc3, d6pukd2, d6pukf1, d6pukf2, d6pukh1, d6pukh2
   automated match to d2axha1
   complexed with act, gol, na, oyv

Details for d6puke1

PDB Entry: 6puk, 2.08 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-jym72

PDB Compounds: (E:) Human TCR beta chain

SCOPe Domain Sequences for d6puke1:

Sequence; same for both SEQRES and ATOM records:

>d6puke1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d6puke1:

• d6puke1 is new in SCOPe 2.07-stable
  
• d6puke1 appears in the current release, SCOPe 2.08