Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
Protein automated matches [190961] (22 species) not a true protein |
Species Mycobacterium abscessus [TaxId:36809] [374339] (56 PDB entries) |
Domain d6nw7a1: 6nw7 A:1-227 [380818] Other proteins in same PDB: d6nw7a2, d6nw7b2 automated match to d1oy5a_ protein/RNA complex; complexed with sah, so4 |
PDB Entry: 6nw7 (more details), 1.48 Å
SCOPe Domain Sequences for d6nw7a1:
Sequence, based on SEQRES records: (download)
>d6nw7a1 c.116.1.0 (A:1-227) automated matches {Mycobacterium abscessus [TaxId: 36809]} mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaqedshsegmaslle gpsytrppswrgmdvppvllsgdhakiaawraeqsrqrtierrpdll
>d6nw7a1 c.116.1.0 (A:1-227) automated matches {Mycobacterium abscessus [TaxId: 36809]} mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnasllegpsytrppswrgm dvppvllsgdhakiaawraeqsrqrtierrpdll
Timeline for d6nw7a1: