SCOPe 2.07: Domain d6nxwa1: 6nxw A:3-251

Lineage for d6nxwa1 (6nxw A:3-251)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (25 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [268515] (8 PDB entries)

8. Domain d6nxwa1: 6nxw A:3-251 [380754]
   Other proteins in same PDB: d6nxwa2, d6nxwb2, d6nxwc2
   automated match to d1tmha_
   mutant

Details for d6nxwa1

PDB Entry: 6nxw, 1.95 Å

PDB Description: crystal structure of arabidopsis thaliana cytosolic triosephosphate isomerase c218s mutant

PDB Compounds: (A:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d6nxwa1:

Sequence; same for both SEQRES and ATOM records:

>d6nxwa1 c.1.1.0 (A:3-251) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdffv
aaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaqgl
kviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspaqa
qevhdelrkwlaknvsadvaattriiyggsvnggnskelggqadvdgflvggaslkpefi
diikaaevk

Timeline for d6nxwa1:

• d6nxwa1 is new in SCOPe 2.07-stable
  
• d6nxwa1 appears in the current release, SCOPe 2.08