Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) |
Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (2 PDB entries) |
Domain d1ekmb2: 1ekm B:17-115 [38055] Other proteins in same PDB: d1ekma1, d1ekmb1, d1ekmc1 |
PDB Entry: 1ekm (more details), 2.5 Å
SCOP Domain Sequences for d1ekmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekmb2 d.17.2.1 (B:17-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha)} aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp rlayyvileagkpgvkeglvdlaslsvietraletvqpi
Timeline for d1ekmb2: