Lineage for d6qjua_ (6qju A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320278Domain d6qjua_: 6qju A: [380458]
    automated match to d5u2fa_
    complexed with dms, edo, j58, na, scn

Details for d6qjua_

PDB Entry: 6qju (more details), 1.2 Å

PDB Description: crystal structure of human bromodomain containing protein 3 (brd3) in complex with 3-bromo-1h-indazol-5-amine
PDB Compounds: (A:) Bromodomain-containing protein 3

SCOPe Domain Sequences for d6qjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qjua_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktnqlqymqnvvvktlwkhqfawpfyqpvdaiklnlpdyhkiiknpmdmgtikkrlenn
yywsasecmqdfntmftncyiynkptddivlmaqalekiflqkvaqmpqee

SCOPe Domain Coordinates for d6qjua_:

Click to download the PDB-style file with coordinates for d6qjua_.
(The format of our PDB-style files is described here.)

Timeline for d6qjua_: