SCOPe 2.07: Domain d6jf3b_: 6jf3 B:

Lineage for d6jf3b_ (6jf3 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [380329] (6 PDB entries)

8. Domain d6jf3b_: 6jf3 B: [380359]
   automated match to d2defa_
   complexed with bb2, zn

Details for d6jf3b_

PDB Entry: 6jf3, 2.01 Å

PDB Description: actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d6jf3b_:

Sequence, based on SEQRES records:

>d6jf3b_ d.167.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
svvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskr
viivasrpnprypdapemnavvmvnpeilefssemclgeegclsvpdergqveraemvkv
kyltlqgemvetvfqgfparivqhevdhlngilfveris

Sequence, based on observed residues (ATOM records):

>d6jf3b_ d.167.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
svvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskr
viivasnavvmvnpeilefssemclgeegclsvpergqveraemvkvkyltlqgemvetv
fqgfparivqhevdhlngilfveris

Timeline for d6jf3b_:

• d6jf3b_ is new in SCOPe 2.07-stable
  
• d6jf3b_ appears in the current release, SCOPe 2.08