SCOPe 2.07: Domain d6jewa_: 6jew A:

Lineage for d6jewa_ (6jew A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (10 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:1409923] [380325] (6 PDB entries)

8. Domain d6jewa_: 6jew A: [380328]
   automated match to d1bs4a_
   complexed with k3u, zn

Details for d6jewa_

PDB Entry: 6jew, 2 Å

PDB Description: k3u bound crystal peptide deformylase from acinetobacter baumanii

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6jewa_:

Sequence, based on SEQRES records:

>d6jewa_ d.167.1.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 1409923]}
llpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivmd
lseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafei
eadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekva

Sequence, based on observed residues (ATOM records):

>d6jewa_ d.167.1.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 1409923]}
llpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivmd
lseskdepmvfinpkvtplttqpyeegclsvpqiydkvdrpsrvkieainlegqafeiea
dgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekva

Timeline for d6jewa_:

• d6jewa_ is new in SCOPe 2.07-stable
  
• d6jewa_ appears in the current release, SCOPe 2.08