Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (25 species) not a true protein |
Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries) |
Domain d6xwya1: 6xwy A:3-221 [380292] Other proteins in same PDB: d6xwya2, d6xwyc2, d6xwyd2 automated match to d4ohsa_ complexed with edo, mla |
PDB Entry: 6xwy (more details), 1.75 Å
SCOPe Domain Sequences for d6xwya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xwya1 d.22.1.0 (A:3-221) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} likenmrmkvvmegsvnghqfkctgegegrpyegvqtmrikvieggplpfafdilatsfm ygsrtfikypadipdffkqsfpegftwervtryedggvvtvtqdtsledgelvynvkvrg vnfpsngpvmqkktkgweadtemmypadgglrgyldralkvdggghlhcnfvttyrskkt vgdikmpgvhavdhrlerieesdnetyvvqrevavakys
Timeline for d6xwya1: