SCOPe 2.07: Domain d6xwya1: 6xwy A:3-221

Lineage for d6xwya1 (6xwy A:3-221)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (25 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries)

8. Domain d6xwya1: 6xwy A:3-221 [380292]
   Other proteins in same PDB: d6xwya2, d6xwyc2, d6xwyd2
   automated match to d4ohsa_
   complexed with edo, mla

Details for d6xwya1

PDB Entry: 6xwy, 1.75 Å

PDB Description: highly ph-resistant long stokes-shift, red fluorescent protein mcrispred

PDB Compounds: (A:) Red fluorescent protein eqFP611

SCOPe Domain Sequences for d6xwya1:

Sequence; same for both SEQRES and ATOM records:

>d6xwya1 d.22.1.0 (A:3-221) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
likenmrmkvvmegsvnghqfkctgegegrpyegvqtmrikvieggplpfafdilatsfm
ygsrtfikypadipdffkqsfpegftwervtryedggvvtvtqdtsledgelvynvkvrg
vnfpsngpvmqkktkgweadtemmypadgglrgyldralkvdggghlhcnfvttyrskkt
vgdikmpgvhavdhrlerieesdnetyvvqrevavakys

Timeline for d6xwya1:

• d6xwya1 is new in SCOPe 2.07-stable
  
• d6xwya1 appears in the current release, SCOPe 2.08