Lineage for d1d6zb3 (1d6z B:186-300)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640512Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1640642Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 1640654Domain d1d6zb3: 1d6z B:186-300 [38018]
    Other proteins in same PDB: d1d6za1, d1d6za4, d1d6zb1, d1d6zb4
    complexed with ca, cu, gol, hy1, pea, peo

Details for d1d6zb3

PDB Entry: 1d6z (more details), 2.1 Å

PDB Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1d6zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6zb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d1d6zb3:

Click to download the PDB-style file with coordinates for d1d6zb3.
(The format of our PDB-style files is described here.)

Timeline for d1d6zb3: