Lineage for d6qgub_ (6qgu B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350574Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)
  8. 2350582Domain d6qgub_: 6qgu B: [379828]
    automated match to d4i15a_
    complexed with 863, fmt, gai, gol, mg, zn

Details for d6qgub_

PDB Entry: 6qgu (more details), 1.77 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-1361
PDB Compounds: (B:) phosphodiesterase

SCOPe Domain Sequences for d6qgub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qgub_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervlet

SCOPe Domain Coordinates for d6qgub_:

Click to download the PDB-style file with coordinates for d6qgub_.
(The format of our PDB-style files is described here.)

Timeline for d6qgub_: