SCOPe 2.07: Domain d6jwcl1: 6jwc L:0-107

Lineage for d6jwcl1 (6jwc L:0-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6jwcl1: 6jwc L:0-107 [379797]
   Other proteins in same PDB: d6jwcl2
   automated match to d1gm3l1
   complexed with 12p, o4b, peg, so4

Details for d6jwcl1

PDB Entry: 6jwc, 2.3 Å

PDB Description: mouse antibody 2b5 fab in complex with peg

PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d6jwcl1:

Sequence; same for both SEQRES and ATOM records:

>d6jwcl1 b.1.1.0 (L:0-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspaimsafpgervtltcsasssvrssylcwyqqkpgsspklwiystsklpsgvp
arfsgsgsgtsysltissmeaedaasyfchqwssyprtfgggtkleik

Timeline for d6jwcl1:

• d6jwcl1 is new in SCOPe 2.07-stable
  
• d6jwcl1 appears in the current release, SCOPe 2.08