Lineage for d6l1vg_ (6l1v G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380780Protein automated matches [190545] (9 species)
    not a true protein
  7. 2380800Species Alcaligenes xylosoxydans [TaxId:85698] [379770] (1 PDB entry)
  8. 2380804Domain d6l1vg_: 6l1v G: [379774]
    automated match to d1rkra_
    complexed with cu

Details for d6l1vg_

PDB Entry: 6l1v (more details), 2.25 Å

PDB Description: domain-swapped alcaligenes xylosoxidans azurin dimer
PDB Compounds: (G:) Azurin-1

SCOPe Domain Sequences for d6l1vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l1vg_ b.6.1.1 (G:) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
aecsvdiagndqmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagqdyayfcsfpghfal
mkgvlklvd

SCOPe Domain Coordinates for d6l1vg_:

Click to download the PDB-style file with coordinates for d6l1vg_.
(The format of our PDB-style files is described here.)

Timeline for d6l1vg_: