Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Alcaligenes xylosoxydans [TaxId:85698] [379770] (1 PDB entry) |
Domain d6l1vg_: 6l1v G: [379774] automated match to d1rkra_ complexed with cu |
PDB Entry: 6l1v (more details), 2.25 Å
SCOPe Domain Sequences for d6l1vg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l1vg_ b.6.1.1 (G:) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]} aecsvdiagndqmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagqdyayfcsfpghfal mkgvlklvd
Timeline for d6l1vg_: