Lineage for d6vdja1 (6vdj A:7-155)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454299Species Apicomplexa sp. [TaxId:2041159] [379703] (3 PDB entries)
  8. 2454302Domain d6vdja1: 6vdj A:7-155 [379717]
    Other proteins in same PDB: d6vdja2, d6vdjb2
    automated match to d2ewda3
    complexed with so4, txd

Details for d6vdja1

PDB Entry: 6vdj (more details), 2 Å

PDB Description: crystal structure of ancestral apicomplexan lactate dehydrogenase with sulfate and nadh4.
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d6vdja1:

Sequence, based on SEQRES records: (download)

>d6vdja1 c.2.1.0 (A:7-155) automated matches {Apicomplexa sp. [TaxId: 2041159]}
krpkisligsgmiggtmaylcalkelgdvvlfdvvknmpqgkaldlshstsvadtnvkvt
gtnsyedikgsdvviitagltkvpgksdkewsrddllpinakimkevgenikkycpnafv
icitnpldvmvkvlqeasglphnkvcgma

Sequence, based on observed residues (ATOM records): (download)

>d6vdja1 c.2.1.0 (A:7-155) automated matches {Apicomplexa sp. [TaxId: 2041159]}
krpkisligsgmiggtmaylcalkelgdvvlfdvvknmpqgkaldlshstsvadtnvkvt
gtnsyedikgsdvviitagltddllpinakimkevgenikkycpnafvicitnpldvmvk
vlqeasglphnkvcgma

SCOPe Domain Coordinates for d6vdja1:

Click to download the PDB-style file with coordinates for d6vdja1.
(The format of our PDB-style files is described here.)

Timeline for d6vdja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6vdja2