SCOPe 2.07: Domain d6vdha2: 6vdh A:156-323

Lineage for d6vdha2 (6vdh A:156-323)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Apicomplexa sp. [TaxId:2041159] [379705] (3 PDB entries)

8. Domain d6vdha2: 6vdh A:156-323 [379711]
   Other proteins in same PDB: d6vdha1, d6vdhb1
   automated match to d2ewda4
   complexed with so4

Details for d6vdha2

PDB Entry: 6vdh, 1.85 Å

PDB Description: crystal structure of ancestral apicomplexan lactate dehydrogenase in alternate dimer configuration with sulfate.

PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d6vdha2:

Sequence; same for both SEQRES and ATOM records:

>d6vdha2 d.162.1.0 (A:156-323) automated matches {Apicomplexa sp. [TaxId: 2041159]}
gvldssrfryfiaeklnvsprdvqamvigahgdnmvplpryvtvngiplqefikkgwitq
eeideivertrnaggeivnllgtgsayfapaasaiamaeaylkdqkrvlpcscylegqyg
vkdlyvgvpvviggngvekvieleltpeekemfdksieevrelvkale

Timeline for d6vdha2:

• d6vdha2 is new in SCOPe 2.07-stable
  
• d6vdha2 appears in the current release, SCOPe 2.08