Lineage for d6soqa_ (6soq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318410Species Synechococcus sp. [TaxId:64471] [362702] (11 PDB entries)
  8. 2318413Domain d6soqa_: 6soq A: [379646]
    automated match to d5u1ba_
    complexed with cl, fe

Details for d6soqa_

PDB Entry: 6soq (more details), 1.67 Å

PDB Description: 2 minute fe2+ soaked structure of synftn variant e62a
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6soqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6soqa_ a.25.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 64471]}
vaqgpngralaesmnpdllsaiqqhisieryasvtylamsiwcaerelagfyqffdgaak
deqshavhftqyliarsqsndlqtldaprqnwdslaslmatafqmeadttssiqsvyala
ernsdtrttvfldplieaqiqsedqfayllgrvkfangdptallvidnelragqtqrg

SCOPe Domain Coordinates for d6soqa_:

Click to download the PDB-style file with coordinates for d6soqa_.
(The format of our PDB-style files is described here.)

Timeline for d6soqa_: