Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Synechococcus sp. [TaxId:64471] [362702] (11 PDB entries) |
Domain d6sooa_: 6soo A: [379639] automated match to d5u1ba_ complexed with fe |
PDB Entry: 6soo (more details), 1.57 Å
SCOPe Domain Sequences for d6sooa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sooa_ a.25.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 64471]} vaqgpngralaesmnpdllsaiqqhisieryasvtylamsiwcaerelagfyqffdgeak deqshavhftqyliarsqsndlqtldaprqnwdslaslmatafqmeadttssiqsvyala ernsdtrttvflaplieaqiqsedqfayllgrvkfangdptallvidnelragqtqrg
Timeline for d6sooa_: