Lineage for d6sooa_ (6soo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318410Species Synechococcus sp. [TaxId:64471] [362702] (11 PDB entries)
  8. 2318411Domain d6sooa_: 6soo A: [379639]
    automated match to d5u1ba_
    complexed with fe

Details for d6sooa_

PDB Entry: 6soo (more details), 1.57 Å

PDB Description: 20 minute fe2+ soaked structure of synftn variant d137a
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6sooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sooa_ a.25.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 64471]}
vaqgpngralaesmnpdllsaiqqhisieryasvtylamsiwcaerelagfyqffdgeak
deqshavhftqyliarsqsndlqtldaprqnwdslaslmatafqmeadttssiqsvyala
ernsdtrttvflaplieaqiqsedqfayllgrvkfangdptallvidnelragqtqrg

SCOPe Domain Coordinates for d6sooa_:

Click to download the PDB-style file with coordinates for d6sooa_.
(The format of our PDB-style files is described here.)

Timeline for d6sooa_: