Lineage for d6l9sa_ (6l9s A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382405Species Roseiflexus castenholzii [TaxId:383372] [379492] (2 PDB entries)
  8. 2382406Domain d6l9sa_: 6l9s A: [379528]
    automated match to d1rkra_
    complexed with cu1

Details for d6l9sa_

PDB Entry: 6l9s (more details), 2 Å

PDB Description: crystal structure of na-dithionite reduced auracyanin from photosynthetic bacterium roseiflexus castenholzii
PDB Compounds: (A:) Blue (Type 1) copper domain protein

SCOPe Domain Sequences for d6l9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9sa_ b.6.1.0 (A:) automated matches {Roseiflexus castenholzii [TaxId: 383372]}
gasttieiasdgenlaydkkeftvptgqtitvtfkntstaqqhnivivkggedvaakvde
eainagppdflpadrtniiaatkmlgpggsetitftapapgtyvflctypahyaggmkgv
mtvap

SCOPe Domain Coordinates for d6l9sa_:

Click to download the PDB-style file with coordinates for d6l9sa_.
(The format of our PDB-style files is described here.)

Timeline for d6l9sa_: