Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries) |
Domain d6j9xb1: 6j9x B:1-262 [379435] Other proteins in same PDB: d6j9xa3, d6j9xb3, d6j9xc3, d6j9xd3 automated match to d3wxla1 complexed with gol |
PDB Entry: 6j9x (more details), 2.7 Å
SCOPe Domain Sequences for d6j9xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j9xb1 c.55.1.0 (B:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]} mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa alnertpimgsigdqqsalfgn
Timeline for d6j9xb1: