SCOP 1.61: Domain d1c0la2: 1c0l A:1194-1288

Lineage for d1c0la2 (1c0l A:1194-1288)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)

5. Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)

6. Protein D-amino acid oxidase [54385] (2 species)

7. Species Yeast (Rhodotorula gracilis) [54387] (4 PDB entries)

8. Domain d1c0la2: 1c0l A:1194-1288 [37936]
   Other proteins in same PDB: d1c0la1

Details for d1c0la2

PDB Entry: 1c0l, 1.73 Å

PDB Description: d-amino acid oxidase: structure of substrate complexes at very high resolution reveal the chemical reacttion mechanism of flavin dehydrogenation

SCOP Domain Sequences for d1c0la2:

Sequence; same for both SEQRES and ATOM records:

>d1c0la2 d.16.1.3 (A:1194-1288) D-amino acid oxidase {Yeast (Rhodotorula gracilis)}
aepirgqtvlvkspckrctmdssdpaspayiiprpggevicggtygvgdwdlsvnpetvq
rilkhclrldptissdgtiegievlrhnvglrpar

Timeline for d1c0la2:

• d1c0la2 first appeared (with stable ids) in SCOP 1.55
  
• d1c0la2 appears in SCOP 1.59
  
• d1c0la2 appears in SCOP 1.63
  
• d1c0la2 appears in the current release, SCOPe 2.08