Lineage for d6u6nc_ (6u6n C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2387221Protein automated matches [190204] (3 species)
    not a true protein
  7. 2387222Species Human (Homo sapiens) [TaxId:9606] [186956] (14 PDB entries)
  8. 2387239Domain d6u6nc_: 6u6n C: [379350]
    automated match to d1c3ha_
    complexed with cl; mutant

Details for d6u6nc_

PDB Entry: 6u6n (more details), 2.15 Å

PDB Description: structure of the trimeric globular domain of adiponectin mutant - d187a q188a
PDB Compounds: (C:) Adiponectin

SCOPe Domain Sequences for d6u6nc_:

Sequence, based on SEQRES records: (download)

>d6u6nc_ b.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymkd
vkvslfkkdkamlftyaayqennvdqasgsvllhlevgdqvwlqvygegernglyadndn
dstftgfllyhdtn

Sequence, based on observed residues (ATOM records): (download)

>d6u6nc_ b.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymkd
vkvslfkkdkamlftyaayqennvdqasgsvllhlevgdqvwlqvygegendstftgfll
yhdtn

SCOPe Domain Coordinates for d6u6nc_:

Click to download the PDB-style file with coordinates for d6u6nc_.
(The format of our PDB-style files is described here.)

Timeline for d6u6nc_: