SCOPe 2.07: Domain d6q27b1: 6q27 B:2-123

Lineage for d6q27b1 (6q27 B:2-123)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [379274] (3 PDB entries)

8. Domain d6q27b1: 6q27 B:2-123 [379299]
   automated match to d2gupa1
   complexed with bm3

Details for d6q27b1

PDB Entry: 6q27, 2.2 Å

PDB Description: n-acetylmannosamine kinase with n-acetylmannosamine from staphylococcus aureus

PDB Compounds: (B:) Glucokinase

SCOPe Domain Sequences for d6q27b1:

Sequence; same for both SEQRES and ATOM records:

>d6q27b1 c.55.1.0 (B:2-123) automated matches {Staphylococcus aureus [TaxId: 1280]}
yyiaidiggtqiksavidkqlnmfdyqqistpdnkselitdkvyeivtgymkqyqliqpv
igissagvvdeqkgeivyagptipnykgtnfkrllkslspyvkvkndvnaallgelklhq
yq

Timeline for d6q27b1:

• d6q27b1 is new in SCOPe 2.07-stable
  
• d6q27b1 appears in the current release, SCOPe 2.08