Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (15 species) not a true protein |
Species Methanotorris igneus [TaxId:2189] [379246] (3 PDB entries) |
Domain d6pjwf_: 6pjw F: [379262] automated match to d1ki9b_ complexed with amp, mg |
PDB Entry: 6pjw (more details), 2.4 Å
SCOPe Domain Sequences for d6pjwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pjwf_ c.37.1.1 (F:) automated matches {Methanotorris igneus [TaxId: 2189]} knkvvvvtgvpgvggttltqktieklkeegieykmvnfgtvmfevakeeglvedrdqmrk ldpdtqkriqklagrkiaemakesnvivdthstvktpkgylaglpiwvleelnpdiiviv etssdeilmrrlgdatrnrdieltsdidehqfmnrcaamaygvltgatvkiiknrdglld kaveelisvlk
Timeline for d6pjwf_: