SCOPe 2.07: Domain d6v3qa1: 6v3q A:1-225

Lineage for d6v3qa1 (6v3q A:1-225)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)

8. Domain d6v3qa1: 6v3q A:1-225 [379177]
   Other proteins in same PDB: d6v3qa2, d6v3qb2
   automated match to d4wd6b_
   complexed with ipa, ocs, zn

Details for d6v3qa1

PDB Entry: 6v3q, 2.4 Å

PDB Description: crystal structure of the metallo-beta-lactamase fim-1 from pseudomonas aeruginosa in the mono-zinc form

PDB Compounds: (A:) Metallo-beta-lactamase FIM-1

SCOPe Domain Sequences for d6v3qa1:

Sequence; same for both SEQRES and ATOM records:

>d6v3qa1 d.157.1.0 (A:1-225) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
qpkdvpvtftaitqgvwmhtsmkhmenwghvpsnglivekgdfsilvdtawddpqtaqii
ewskdtlkkpirwavfthahddkmggvaalrqqgivtyaaadsnrmapqngltpaehdli
fdsehstsvlhplvifdpgpghtrdnivvglpeqgivfggclirpsgstslgntadadla
hwktavlavaqrfaeaqqiipshgpmagrelfeltaqlaekasip

Timeline for d6v3qa1:

• d6v3qa1 is new in SCOPe 2.07-stable
  
• d6v3qa1 appears in the current release, SCOPe 2.08