Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Photorhabdus laumondii [TaxId:243265] [379118] (1 PDB entry) |
Domain d6t5zb_: 6t5z B: [379119] automated match to d2bema_ complexed with cu |
PDB Entry: 6t5z (more details), 1.6 Å
SCOPe Domain Sequences for d6t5zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t5zb_ b.1.18.0 (B:) automated matches {Photorhabdus laumondii [TaxId: 243265]} hgyidspgsraflcsaqgneqnmdcglvkyepqsleakkgfpqagpedghiasagighfg aldaqtedrwkkipitageiefqweimiqhktssweyfitklgwdpnkpltreqfnstpf cfedyqekmpssrvinkctlpegyqgyhvilgvwtisdtlnafyqvidttispa
Timeline for d6t5zb_: