Lineage for d6t5zb_ (6t5z B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376314Species Photorhabdus laumondii [TaxId:243265] [379118] (1 PDB entry)
  8. 2376316Domain d6t5zb_: 6t5z B: [379119]
    automated match to d2bema_
    complexed with cu

Details for d6t5zb_

PDB Entry: 6t5z (more details), 1.6 Å

PDB Description: crystal structure of an aa10 lpmo from photorhabdus luminescens
PDB Compounds: (B:) Chitin-binding type-4 domain-containing protein

SCOPe Domain Sequences for d6t5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t5zb_ b.1.18.0 (B:) automated matches {Photorhabdus laumondii [TaxId: 243265]}
hgyidspgsraflcsaqgneqnmdcglvkyepqsleakkgfpqagpedghiasagighfg
aldaqtedrwkkipitageiefqweimiqhktssweyfitklgwdpnkpltreqfnstpf
cfedyqekmpssrvinkctlpegyqgyhvilgvwtisdtlnafyqvidttispa

SCOPe Domain Coordinates for d6t5zb_:

Click to download the PDB-style file with coordinates for d6t5zb_.
(The format of our PDB-style files is described here.)

Timeline for d6t5zb_: