Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Mus musculus [TaxId:10090] [378951] (1 PDB entry) |
Domain d6kllb1: 6kll B:4-146 [378966] Other proteins in same PDB: d6klla2, d6kllb2, d6kllc2, d6klld2 automated match to d1c0fa1 complexed with adp, mg |
PDB Entry: 6kll (more details), 3 Å
SCOPe Domain Sequences for d6kllb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kllb1 c.55.1.0 (B:4-146) automated matches {Mus musculus [TaxId: 10090]} ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim fetfnvpamyvaiqavlslyasg
Timeline for d6kllb1: