SCOPe 2.07: Domain d6ionl2: 6ion L:109-214

Lineage for d6ionl2 (6ion L:109-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6ionl2: 6ion L:109-214 [378934]
   Other proteins in same PDB: d6ionl1
   automated match to d1h3pl2
   complexed with nag

Details for d6ionl2

PDB Entry: 6ion, 2.75 Å

PDB Description: the complex of c4.4a with its antibody 11h10 fab fragment

PDB Compounds: (L:) anti-C4.4A antibody 11H10, light chain

SCOPe Domain Sequences for d6ionl2:

Sequence; same for both SEQRES and ATOM records:

>d6ionl2 b.1.1.2 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d6ionl2:

• d6ionl2 is new in SCOPe 2.07-stable
  
• d6ionl2 appears in the current release, SCOPe 2.08