Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Human rotavirus a [TaxId:10941] [187643] (14 PDB entries) |
Domain d6niwd_: 6niw D: [378806] automated match to d5vkia_ complexed with peg |
PDB Entry: 6niw (more details), 1.55 Å
SCOPe Domain Sequences for d6niwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6niwd_ b.29.1.0 (D:) automated matches {Human rotavirus a [TaxId: 10941]} dgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfget kqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetphatt dysstsnlsevetvihvefyiiprsqeskcseyintg
Timeline for d6niwd_: