Lineage for d6v54a_ (6v54 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603627Species Hirschia baltica [TaxId:582402] [378684] (2 PDB entries)
  8. 2603628Domain d6v54a_: 6v54 A: [378686]
    automated match to d5a87b_
    complexed with cl, edo, fmt, gol, mg, zn

Details for d6v54a_

PDB Entry: 6v54 (more details), 1.45 Å

PDB Description: crystal structure of metallo beta lactamase from hirschia baltica
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6v54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v54a_ d.157.1.0 (A:) automated matches {Hirschia baltica [TaxId: 582402]}
kpvefvklgtgvwmhtgykvvppwgnirtngliiergdysvlvdtawndaqtaeivawak
dtlqkpirasihthahsdkmggmdalhmlgvetfatdltnrlaierglmpaknvlnisei
gsqiewegltilypggghsednivvnegvnnilfggcmirpgmttslgniddanlgywsk
avenaanafpdsqivipshgkpagreilkntayitrpkl

SCOPe Domain Coordinates for d6v54a_:

Click to download the PDB-style file with coordinates for d6v54a_.
(The format of our PDB-style files is described here.)

Timeline for d6v54a_: