SCOPe 2.07: Domain d6ue2c1: 6ue2 C:41-290

Lineage for d6ue2c1 (6ue2 C:41-290)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Peptoclostridium difficile [TaxId:272563] [378673] (1 PDB entry)

8. Domain d6ue2c1: 6ue2 C:41-290 [378674]
   Other proteins in same PDB: d6ue2c2, d6ue2d2
   automated match to d3isga_
   complexed with gol, kcx, peg, pge, ppi

Details for d6ue2c1

PDB Entry: 6ue2, 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of class d beta-lactamase from clostridium difficile 630

PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d6ue2c1:

Sequence; same for both SEQRES and ATOM records:

>d6ue2c1 e.3.1.0 (C:41-290) automated matches {Peptoclostridium difficile [TaxId: 272563]}
vdysdcfegisggaifyntknkeyniynkelietrrspcstfkivstliglekgvinske
svmgydgteypnknwnknlsleeafkescvwyykklidkvdaksvqnilddlkygncdis
ewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimkidvn
dkninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkeiain
iikkyysvre

Timeline for d6ue2c1:

• d6ue2c1 is new in SCOPe 2.07-stable
  
• d6ue2c1 appears in the current release, SCOPe 2.08