Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
Protein automated matches [190792] (4 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [317430] (8 PDB entries) |
Domain d6qiya_: 6qiy A: [378640] automated match to d5fbzb_ |
PDB Entry: 6qiy (more details), 1.5 Å
SCOPe Domain Sequences for d6qiya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qiya_ d.40.1.1 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} dlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniae vprvg
Timeline for d6qiya_: