SCOPe 2.07: Domain d6ug9l1: 6ug9 L:1-105

Lineage for d6ug9l1 (6ug9 L:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6ug9l1: 6ug9 L:1-105 [378517]
   Other proteins in same PDB: d6ug9b2, d6ug9k2, d6ug9l2
   automated match to d1dn0a1
   complexed with bgc, gal, gla, nga, sia

Details for d6ug9l1

PDB Entry: 6ug9, 2.74 Å

PDB Description: complex of ch28/11 fab and ssea-4 (hexagonal form)

PDB Compounds: (L:) ch28/11 Fab light chain

SCOPe Domain Sequences for d6ug9l1:

Sequence; same for both SEQRES and ATOM records:

>d6ug9l1 b.1.1.0 (L:1-105) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
envltqspaimsaspgekvtmtcsasssvnymhwyqqksstspklwiydtsklasgvpgr
fsgsgsgnsysltirtmeaedvatyfcfqasgypltfgggtklel

Timeline for d6ug9l1:

• d6ug9l1 is new in SCOPe 2.07-stable
  
• d6ug9l1 appears in the current release, SCOPe 2.08