Lineage for d6uh1a_ (6uh1 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431857Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries)
  8. 2431872Domain d6uh1a_: 6uh1 A: [378502]
    Other proteins in same PDB: d6uh1c_
    automated match to d4ceya_
    complexed with sph

Details for d6uh1a_

PDB Entry: 6uh1 (more details), 3.04 Å

PDB Description: structure of the eva71 strain 11316 capsid
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d6uh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uh1a_ b.121.4.0 (A:) automated matches {Enterovirus a71 [TaxId: 39054]}
gdrvadviessigdsvsraltqalpaptgqntqvsshrldtgevpalqaaeigassntsd
esmietrcvlnshstaettldsffsraglvgeidlplegttnpngyanwdiditgyaqmr
rkvelftymrfdaeftfvactptgqvvpqllqymfvppgapkpesreslawqtatnpsvf
vkltdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrtvgs
skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgtsrsaittl

SCOPe Domain Coordinates for d6uh1a_:

Click to download the PDB-style file with coordinates for d6uh1a_.
(The format of our PDB-style files is described here.)

Timeline for d6uh1a_: