Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
Protein automated matches [190838] (16 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [197087] (8 PDB entries) |
Domain d6p58b_: 6p58 B: [378304] automated match to d3vv4a_ complexed with edo, mg, vrb |
PDB Entry: 6p58 (more details), 1.5 Å
SCOPe Domain Sequences for d6p58b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p58b_ d.110.2.0 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} selrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardqviedpc frehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfglliahq aseprqwqeieidqfselastgslvlerlh
Timeline for d6p58b_: