SCOPe 2.07: Domain d6p58b_: 6p58 B:

Lineage for d6p58b_ (6p58 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (16 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [197087] (8 PDB entries)

8. Domain d6p58b_: 6p58 B: [378304]
   automated match to d3vv4a_
   complexed with edo, mg, vrb

Details for d6p58b_

PDB Entry: 6p58, 1.5 Å

PDB Description: dark and steady state-illuminated crystal structure of cyanobacteriochrome receptor pixj at 150k

PDB Compounds: (B:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d6p58b_:

Sequence; same for both SEQRES and ATOM records:

>d6p58b_ d.110.2.0 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
selrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardqviedpc
frehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfglliahq
aseprqwqeieidqfselastgslvlerlh

Timeline for d6p58b_:

• d6p58b_ is new in SCOPe 2.07-stable
  
• d6p58b_ appears in the current release, SCOPe 2.08