SCOPe 2.07: Domain d6neha1: 6neh A:7-103

Lineage for d6neha1 (6neh A:7-103)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Thalictrum flavum [TaxId:150095] [318179] (8 PDB entries)

8. Domain d6neha1: 6neh A:7-103 [378300]
   Other proteins in same PDB: d6neha2, d6nehb2
   automated match to d1kyze1
   complexed with sah, slx; mutant

Details for d6neha1

PDB Entry: 6neh, 1.52 Å

PDB Description: n191d, f205s mutant of scoulerine 9-o-methyltransferase from thalictrum flavum complexed with (13as)-3,10-dimethoxy-5,8,13,13a- tetrahydro-6h-isoquino[3,2-a]isoquinoline-2,9-diol and s-adenosyl-l- homocysteine

PDB Compounds: (A:) (S)-scoulerine 9-O-methyltransferase

SCOPe Domain Sequences for d6neha1:

Sequence; same for both SEQRES and ATOM records:

>d6neha1 a.4.5.0 (A:7-103) automated matches {Thalictrum flavum [TaxId: 150095]}
vnylsglglsrliclpmalraaielnvfeiifqagpeaqlspaeivakiptknpnaaial
drilrmlgassilsvttmkdgrvyglteesrclvadk

Timeline for d6neha1:

• d6neha1 is new in SCOPe 2.07-stable
  
• d6neha1 appears in the current release, SCOPe 2.08