Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Thalictrum flavum [TaxId:150095] [318181] (8 PDB entries) |
Domain d6neib2: 6nei B:104-350 [378288] Other proteins in same PDB: d6neia1, d6neia3, d6neib1 automated match to d1kyzc2 complexed with so4 |
PDB Entry: 6nei (more details), 1.85 Å
SCOPe Domain Sequences for d6neib2:
Sequence, based on SEQRES records: (download)
>d6neib2 c.66.1.0 (B:104-350) automated matches {Thalictrum flavum [TaxId: 150095]} ngvsvvpmllftsdkavvesfynikdvvleegvipfdrthgmdffayagkeqsvnksfnq amgagstiafdevfkvykgfhdlkelvnvgggigtslsniifkyphikginfelphviad apnypgvehiagnmfegvpnaqnillkwvlhdwddersikilqncwkalpeggtvivvef vlpqilgnnaesfnaltpdllmmtlnpggkertttefdglakaagfaetkffpisqglhv mefhkat
>d6neib2 c.66.1.0 (B:104-350) automated matches {Thalictrum flavum [TaxId: 150095]} ngvsvvpmllftsdkavvesfynikdvvleegvipfdrthgmdffaysvnksfnqamgag stiafdevfkvykgfhdlkelvnvgggigtslsniifkyphikginfelphviadapnyp gvehiagnmfegvpnaqnillkwvlhdwddersikilqncwkalpeggtvivvefvlpqi lgnnaesfnaltpdllmmtlnpggkertttefdglakaagfaetkffpisqglhvmefhk at
Timeline for d6neib2: