Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82796] (129 PDB entries) Uniprot P00533 702-1018 |
Domain d6p1dc_: 6p1d C: [378284] automated match to d4zseb_ complexed with anp, mg, nq1; mutant |
PDB Entry: 6p1d (more details), 2.4 Å
SCOPe Domain Sequences for d6p1dc_:
Sequence, based on SEQRES records: (download)
>d6p1dc_ d.144.1.7 (C:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} allrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeild eayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqi akgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwm alesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppicti dvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyral mdeed
>d6p1dc_ d.144.1.7 (C:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} allrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeild eayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqi akgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriythq sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmid adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeed
Timeline for d6p1dc_: